PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KZV48790.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Gesneriaceae; Didymocarpoideae; Trichosporeae; Loxocarpinae; Dorcoceras
Family WOX
Protein Properties Length: 258aa    MW: 28800.5 Da    PI: 9.2774
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KZV48790.1genomeCNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox49.85.9e-162888257
                T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
    Homeobox  2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
                r+R+t+++eq+ +Le+ F++   +p ++e  ++ k l    ++ +++V++WFqNrR + ++
  KZV48790.1 28 RSRWTPKPEQILILESIFNSgMVNPPKNETVRIRKMLekfgSVGDANVFYWFQNRRSRSRR 88
                89*****************99*************************************997 PP

2Wus_type_Homeobox107.67.5e-352790265
  Wus_type_Homeobox  2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65
                       +r+RWtP+peQi iLe++++sG+++P+k+e+ ri+++Le++G ++d+NVfyWFQNr++R+r++q
         KZV48790.1 27 VRSRWTPKPEQILILESIFNSGMVNPPKNETVRIRKMLEKFGSVGDANVFYWFQNRRSRSRRRQ 90
                       589***********************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.2E-132394IPR009057Homeodomain-like
PROSITE profilePS5007111.4672489IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.609.5E-92592IPR009057Homeodomain-like
SMARTSM003894.9E-62693IPR001356Homeobox domain
PfamPF000461.1E-132888IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048830Biological Processadventitious root development
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 258 aa     Download sequence    Send to blast
MYGRVQSTAT RPSSGVEASA DRRQEPVRSR WTPKPEQILI LESIFNSGMV NPPKNETVRI  60
RKMLEKFGSV GDANVFYWFQ NRRSRSRRRQ RQIQAGLATV EPPRVVSGVQ HENRAVAGAL  120
PPNSFCINTS SWLVGSGSSS SRGIADQSDA VPDRFRDFFS YPGLQEIEPT SIFGQPDASN  180
LQYQSAGLIT VFINGVATDV CRGPFDIKAM FGGDFVLFHS SGMPLQANEY GYLVHSLQHG  240
ESYFLVINTY IYIYMITL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011069976.14e-87PREDICTED: WUSCHEL-related homeobox 11-like
SwissprotQ6X7J31e-61WOX11_ARATH; WUSCHEL-related homeobox 11
TrEMBLB9I6531e-71B9I653_POPTR; Uncharacterized protein
TrEMBLB9IPV49e-72B9IPV4_POPTR; Homeobox-leucine zipper transcription factor family protein
STRINGPOPTR_0019s05730.13e-71(Populus trichocarpa)
STRINGPOPTR_0013s06310.13e-71(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA61662231
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G03660.11e-34WUSCHEL related homeobox 11